Build your AI headhunter →

Senior Frontend Engineer, Consumer Web Platform

Wolt
Wolt
Location: Helsinki, Finland; Stockholm, Sweden Posted on: 5 August 2026
FI
🎯 Senior📄 Permanent🏠 Hybrid🧭 Frontend🏢 E-commerce⏳ 5+ yrs🗣️ English
Required skills
javascriptreacttypescripthtmlcssweb performancesecurityobservability

About Wolt

At Wolt, we create technology that brings joy, simplicity and earnings to the neighborhoods of the world. In 2014 we started with delivery of restaurant food. Now we’re building the delivery of (almost) everything and you’ll find us in over 500 cities in 30 countries around the world. In 2022 we joined forces with DoorDash and together we keep on dreaming big and expanding across the globe.

Working at Wolt isn’t always easy, but it’s definitely exciting. Here you’ll learn more, build more, and ship more than in most other companies. You’ll be challenged a lot, but also have a lot of fun on the way. So, if you’re a self-starter with drive and entrepreneurial spirit, this could be the ride of your life.

Wolt is looking for a Senior Frontend Engineer to expand our Consumer Web Platform team. The team is part of the Consumer Product group and is responsible for enabling the delivery of the consumer web apps – most notably wolt.com – that millions of people in over 32 countries around the world see when ordering food and other products.

Our client platform teams share a clear mission:

“Enable delivery and ownership of Wolt-grade Consumer Client Applications through engineering excellence and domain expertise.”

What You’ll Be Doing

If you love collaborating with multiple engineering stakeholders, focusing on the long-term quality of the user experience, and making life easier for fellow engineers, this is the team for you!

📍This role can be based in one of our tech hubs in Helsinki or Stockholm. Read more about our hybrid setup here.

🤖 AI-First Engineering - What This Means Here

We're building teams at the forefront of agentic coding. This isn't about using Copilot to autocomplete boilerplate. We mean engineers who:

If you find yourself naturally asking "can an agent do this?" before reaching for the keyboard, you'll fit right in.

Feel free to check out the Wolt Tech Blog for more insight into our culture and technology.

Must haves

Nice to haves

Why Join Us?

Our Commitment to Diversity and Inclusion

We’re committed to growing and empowering a more inclusive community within our company, industry, and cities. That’s why we hire and cultivate diverse teams of people from all backgrounds, experiences, and perspectives. We believe that true innovation happens when everyone has room at the table and the tools, resources, and opportunity to excel.

Ready to interview?

Upload your CV on tailk.me and let the AI run the interview for you.

Build your AI headhunter and interview

Related listings

Senior Backend Engineer, Wolt+
Wolt
Helsinki, Finland
Senior Applied Scientist, Operations Research
Wolt
Berlin, Germany; Helsinki, Finland; Stockholm, Sweden
Senior Corporate Infrastructure Engineer
Wolt
Berlin, Germany; Budapest, Hungary; Helsinki, Finland; London, United Kingdom; Stockholm, Sweden; Tallinn, Estonia
Senior Data Scientist, Wolt+ Analytics
Wolt
Helsinki, Finland; Stockholm, Sweden · Remote
Senior Data Scientist, Consumer Product Analytics
Wolt
Berlin, Germany; Helsinki, Finland; Stockholm, Sweden · Remote
Senior CRM Designer (Email Developer)
Wolt
Athens, Greece; Berlin, Germany; Helsinki, Finland